Lineage for d2bl5a1 (2bl5 A:1-134)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947085Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2947086Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947087Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2947151Protein Quaking protein A (Xqua) [143226] (1 species)
  7. 2947152Species African clawed frog (Xenopus laevis) [TaxId:8355] [143227] (1 PDB entry)
    Uniprot Q32NN2 82-215
  8. 2947153Domain d2bl5a1: 2bl5 A:1-134 [128728]
    Other proteins in same PDB: d2bl5a2
    has additional insertions and/or extensions that are not grouped together

Details for d2bl5a1

PDB Entry: 2bl5 (more details)

PDB Description: solution structure of the kh-qua2 region of the xenopus star-gsg quaking protein.
PDB Compounds: (A:) mgc83862 protein

SCOPe Domain Sequences for d2bl5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]}
qlqeklyvpvkeypdfnfvgrilgprgltakqleaetgckimvrgkgsmrdkkkeeqnrg
kpnwehlnedlhvlitvedaqnraelklkraveevkkllvpaaegedslkkmklmelail
ngtyrdanlkspal

SCOPe Domain Coordinates for d2bl5a1:

Click to download the PDB-style file with coordinates for d2bl5a1.
(The format of our PDB-style files is described here.)

Timeline for d2bl5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bl5a2