Lineage for d2bkzc1 (2bkz C:0-297)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 734916Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 734926Species Human (Homo sapiens) [TaxId:9606] [88856] (124 PDB entries)
  8. 735056Domain d2bkzc1: 2bkz C:0-297 [128722]
    Other proteins in same PDB: d2bkzb1, d2bkzb2, d2bkzd1, d2bkzd2
    automatically matched to d1vywa_
    complexed with sbc, so4

Details for d2bkzc1

PDB Entry: 2bkz (more details), 2.6 Å

PDB Description: structure of cdk2-cyclin a with pha-404611
PDB Compounds: (C:) Cell division protein kinase 2

SCOP Domain Sequences for d2bkzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkzc1 d.144.1.7 (C:0-297) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
dmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

SCOP Domain Coordinates for d2bkzc1:

Click to download the PDB-style file with coordinates for d2bkzc1.
(The format of our PDB-style files is described here.)

Timeline for d2bkzc1: