![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (3 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (8 proteins) |
![]() | Protein Cyclin A [47956] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47957] (52 PDB entries) Uniprot P20248 175-432 |
![]() | Domain d2bkzb1: 2bkz B:181-308 [128720] Other proteins in same PDB: d2bkza_, d2bkzc_ automatically matched to d1vin_1 complexed with sbc, so4 |
PDB Entry: 2bkz (more details), 2.6 Å
SCOPe Domain Sequences for d2bkzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkzb1 a.74.1.1 (B:181-308) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk vltfdlaa
Timeline for d2bkzb1:
![]() Domains from other chains: (mouse over for more information) d2bkza_, d2bkzc_, d2bkzd1, d2bkzd2 |