Lineage for d2bkyx_ (2bky X:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199715Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2200050Superfamily d.68.6: AlbA-like [82704] (3 families) (S)
  5. 2200051Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins)
  6. 2200052Protein DNA-binding protein AlbA [82706] (4 species)
    an archaeal chromatin protein modulated by acetylation, a Sir2 substrate
  7. 2200063Species Sulfolobus solfataricus, Sso10b2 [TaxId:2287] [103058] (3 PDB entries)
    gene SSO6877 (AlbA2)
  8. 2200064Domain d2bkyx_: 2bky X: [128717]
    Other proteins in same PDB: d2bkya_, d2bkyb_
    automated match to d1udva_
    complexed with mpd

Details for d2bkyx_

PDB Entry: 2bky (more details), 1.7 Å

PDB Description: crystal structure of the alba1:alba2 heterodimer from sulfolobus solfataricus
PDB Compounds: (X:) DNA/RNA-binding protein Alba 2

SCOPe Domain Sequences for d2bkyx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkyx_ d.68.6.1 (X:) DNA-binding protein AlbA {Sulfolobus solfataricus, Sso10b2 [TaxId: 2287]}
klneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdgvql
vnvqtgsevrdrrrisyillrlkrvy

SCOPe Domain Coordinates for d2bkyx_:

Click to download the PDB-style file with coordinates for d2bkyx_.
(The format of our PDB-style files is described here.)

Timeline for d2bkyx_: