| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.68: IF3-like [55199] (7 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.6: AlbA-like [82704] (2 families) ![]() |
| Family d.68.6.1: DNA-binding protein AlbA [82705] (1 protein) |
| Protein DNA-binding protein AlbA [82706] (4 species) an archaeal chromatin protein modulated by acetylation, a Sir2 substrate |
| Species Archaeon Sulfolobus solfataricus, Sso10b2 [TaxId:2287] [103058] (3 PDB entries) gene SSO6877 (AlbA2) |
| Domain d2bkyx1: 2bky X:4-89 [128717] automatically matched to d1udva_ complexed with mpd |
PDB Entry: 2bky (more details), 1.7 Å
SCOP Domain Sequences for d2bkyx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkyx1 d.68.6.1 (X:4-89) DNA-binding protein AlbA {Archaeon Sulfolobus solfataricus, Sso10b2 [TaxId: 2287]}
klneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdgvql
vnvqtgsevrdrrrisyillrlkrvy
Timeline for d2bkyx1: