SCOP 1.73: Domain d2bkyx1: 2bky X:4-89

Lineage for d2bkyx1 (2bky X:4-89)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.68: IF3-like [55199] (7 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.6: AlbA-like [82704] (2 families)

5. Family d.68.6.1: DNA-binding protein AlbA [82705] (1 protein)

6. Protein DNA-binding protein AlbA [82706] (4 species)
   an archaeal chromatin protein modulated by acetylation, a Sir2 substrate

7. Species Archaeon Sulfolobus solfataricus, Sso10b2 [TaxId:2287] [103058] (3 PDB entries)
   gene SSO6877 (AlbA2)

8. Domain d2bkyx1: 2bky X:4-89 [128717]
   automatically matched to d1udva_
   complexed with mpd

Details for d2bkyx1

PDB Entry: 2bky, 1.7 Å

PDB Description: crystal structure of the alba1:alba2 heterodimer from sulfolobus solfataricus

PDB Compounds: (X:) DNA/RNA-binding protein Alba 2

SCOP Domain Sequences for d2bkyx1:

Sequence; same for both SEQRES and ATOM records:

>d2bkyx1 d.68.6.1 (X:4-89) DNA-binding protein AlbA {Archaeon Sulfolobus solfataricus, Sso10b2 [TaxId: 2287]}
klneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdgvql
vnvqtgsevrdrrrisyillrlkrvy

Timeline for d2bkyx1:

• d2bkyx1 is new in SCOP 1.73
  
• d2bkyx1 appears in SCOP 1.75
  
• d2bkyx1 appears in the current release, SCOPe 2.08, called d2bkyx_