SCOPe 2.02: Domain d2bkyb_: 2bky B:

Lineage for d2bkyb_ (2bky B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.6: AlbA-like [82704] (3 families)

5. Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins)

6. Protein automated matches [190221] (3 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [186981] (1 PDB entry)

8. Domain d2bkyb_: 2bky B: [128716]
   Other proteins in same PDB: d2bkyx_, d2bkyy_
   automated match to d1h0xa_
   complexed with mpd

Details for d2bkyb_

PDB Entry: 2bky, 1.7 Å

PDB Description: crystal structure of the alba1:alba2 heterodimer from sulfolobus solfataricus

PDB Compounds: (B:) DNA/RNA-binding protein alba 1

SCOPe Domain Sequences for d2bkyb_:

Sequence; same for both SEQRES and ATOM records:

>d2bkyb_ d.68.6.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
snvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdkieik
eirvgsqvvtsqdgrqsrvstieiairkk

Timeline for d2bkyb_:

• d2bkyb_ first appeared in SCOP 1.73, called d2bkyb1
  
• d2bkyb_ appears in SCOPe 2.01
  
• d2bkyb_ appears in SCOPe 2.03
  
• d2bkyb_ appears in the current release, SCOPe 2.08