Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.6: AlbA-like [82704] (3 families) |
Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins) |
Protein automated matches [190221] (3 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:273057] [186981] (1 PDB entry) |
Domain d2bkyb_: 2bky B: [128716] Other proteins in same PDB: d2bkyx_, d2bkyy_ automated match to d1h0xa_ complexed with mpd |
PDB Entry: 2bky (more details), 1.7 Å
SCOPe Domain Sequences for d2bkyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkyb_ d.68.6.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 273057]} snvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdkieik eirvgsqvvtsqdgrqsrvstieiairkk
Timeline for d2bkyb_: