Lineage for d2bkyb1 (2bky B:9-97)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864751Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 864892Superfamily d.68.6: AlbA-like [82704] (2 families) (S)
  5. 864893Family d.68.6.1: DNA-binding protein AlbA [82705] (1 protein)
  6. 864894Protein DNA-binding protein AlbA [82706] (4 species)
    an archaeal chromatin protein modulated by acetylation, a Sir2 substrate
  7. 864901Species Archaeon Sulfolobus solfataricus, Sso10b1 [TaxId:2287] [82707] (3 PDB entries)
    gene SSO0962 (AlbA1)
  8. 864903Domain d2bkyb1: 2bky B:9-97 [128716]
    automatically matched to d1h0xa_
    complexed with mpd

Details for d2bkyb1

PDB Entry: 2bky (more details), 1.7 Å

PDB Description: crystal structure of the alba1:alba2 heterodimer from sulfolobus solfataricus
PDB Compounds: (B:) DNA/RNA-binding protein alba 1

SCOP Domain Sequences for d2bkyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkyb1 d.68.6.1 (B:9-97) DNA-binding protein AlbA {Archaeon Sulfolobus solfataricus, Sso10b1 [TaxId: 2287]}
snvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdkieik
eirvgsqvvtsqdgrqsrvstieiairkk

SCOP Domain Coordinates for d2bkyb1:

Click to download the PDB-style file with coordinates for d2bkyb1.
(The format of our PDB-style files is described here.)

Timeline for d2bkyb1: