Lineage for d2bkwa1 (2bkw A:3-384)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131439Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2131451Protein Alanine-glyoxylate aminotransferase [89757] (3 species)
  7. 2131452Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142664] (1 PDB entry)
    Uniprot P43567 3-384
  8. 2131453Domain d2bkwa1: 2bkw A:3-384 [128714]
    complexed with glv, plp

Details for d2bkwa1

PDB Entry: 2bkw (more details), 2.57 Å

PDB Description: yeast alanine:glyoxylate aminotransferase yfl030w
PDB Compounds: (A:) alanine-glyoxylate aminotransferase 1

SCOPe Domain Sequences for d2bkwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ksvdtllipgpiilsgavqkaldvpslghtspefvsifqrvlkntravfksaaasksqpf
vlagsgtlgwdifasnfilskapnknvlvvstgtfsdrfadclrsygaqvdvvrplkige
svpleliteklsqnsygavtvthvdtstavlsdlkaisqaikqtspetffvvdavcsigc
eefefdewgvdfaltasqkaigapaglsislcssrfmdyalndsknghvhgyfsslrrwt
pimenyeagkgayfatppvqlinsldvalkeileeglhkrwdlhremsdwfkdslvnglq
ltsvsrypsnmsahgltavyvadppdviaflkshgvviaggihkdigpkyirighmgvta
cnknlpymkncfdliklalqrk

SCOPe Domain Coordinates for d2bkwa1:

Click to download the PDB-style file with coordinates for d2bkwa1.
(The format of our PDB-style files is described here.)

Timeline for d2bkwa1: