Lineage for d2bkud_ (2bku D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006908Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2006909Protein automated matches [190220] (14 species)
    not a true protein
  7. 2006920Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186980] (6 PDB entries)
  8. 2006926Domain d2bkud_: 2bku D: [128713]
    Other proteins in same PDB: d2bkua_, d2bkub1, d2bkuc_
    automated match to d1qgka_
    complexed with gtp, mg

Details for d2bkud_

PDB Entry: 2bku (more details), 2.7 Å

PDB Description: kap95p:rangtp complex
PDB Compounds: (D:) importin beta-1 subunit

SCOPe Domain Sequences for d2bkud_:

Sequence, based on SEQRES records: (download)

>d2bkud_ a.118.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadpqsqalvsssnni
liaivqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaediev
qaaafgclckimskyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidi
ayelaqfpqsplqsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaq
ncgnhilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlm
ndqslqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinl
veqlaeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsa
sistfvmdklgqtmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmg
lffrllekkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitav
gfiadisnsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipy
lndimalcvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtif
qfiaqvaedpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlf
sqatkdtarwareqqkrqlsl

Sequence, based on observed residues (ATOM records): (download)

>d2bkud_ a.118.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadpqsqalvsssnni
liaivqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaediev
qaaafgclckimskyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidi
ayelaqfpqsplqsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaq
ncgnhilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlm
ndqslqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinl
veqlaeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsa
sistfvmdklgqtmsvedaqslqelqsniltvlaavirkspssvepvadmlmglffrlle
kkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitavgfiadis
nsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipylndimal
cvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtifqfiaqva
edpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlfsqatkdt
arwareqqkrqlsl

SCOPe Domain Coordinates for d2bkud_:

Click to download the PDB-style file with coordinates for d2bkud_.
(The format of our PDB-style files is described here.)

Timeline for d2bkud_: