Lineage for d2bkrb_ (2bkr B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1637453Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1638052Protein automated matches [190118] (10 species)
    not a true protein
  7. 1638076Species Human (Homo sapiens) [TaxId:9606] [189560] (70 PDB entries)
  8. 1638099Domain d2bkrb_: 2bkr B: [128711]
    Other proteins in same PDB: d2bkra_
    automated match to d1nddb_

Details for d2bkrb_

PDB Entry: 2bkr (more details), 1.9 Å

PDB Description: nedd8 nedp1 complex
PDB Compounds: (B:) Neddylin

SCOPe Domain Sequences for d2bkrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkrb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaady
kilggsvlhlvlalrgg

SCOPe Domain Coordinates for d2bkrb_:

Click to download the PDB-style file with coordinates for d2bkrb_.
(The format of our PDB-style files is described here.)

Timeline for d2bkrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bkra_