SCOPe 2.08: Domain d2bkrb2: 2bkr B:1-76

Lineage for d2bkrb2 (2bkr B:1-76)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries)

8. Domain d2bkrb2: 2bkr B:1-76 [128711]
   Other proteins in same PDB: d2bkra_, d2bkrb3
   automated match to d1nddb_

Details for d2bkrb2

PDB Entry: 2bkr, 1.9 Å

PDB Description: nedd8 nedp1 complex

PDB Compounds: (B:) Neddylin

SCOPe Domain Sequences for d2bkrb2:

Sequence; same for both SEQRES and ATOM records:

>d2bkrb2 d.15.1.1 (B:1-76) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgg

Timeline for d2bkrb2:

• d2bkrb2 first appeared in SCOP 1.73, called d2bkrb1
  
• d2bkrb2 was called d2bkrb_ in SCOPe 2.07