![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (23 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.7: Adenain-like [54054] (6 proteins) Pfam PF02902; Ulp1 protease family |
![]() | Protein automated matches [190219] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186979] (4 PDB entries) |
![]() | Domain d2bkra_: 2bkr A: [128710] Other proteins in same PDB: d2bkrb_ automated match to d1xt9a_ |
PDB Entry: 2bkr (more details), 1.9 Å
SCOPe Domain Sequences for d2bkra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkra_ d.3.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds hsrsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffr qqtesllqlltpayitkkrgewkdliatlakk
Timeline for d2bkra_: