SCOP 1.73: Domain d2bkra1: 2bkr A:1-212

Lineage for d2bkra1 (2bkr A:1-212)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (16 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (5 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Sentrin-specific protease 8, SENP8 [117760] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117761] (3 PDB entries)

8. Domain d2bkra1: 2bkr A:1-212 [128710]
   Other proteins in same PDB: d2bkrb1
   automatically matched to 2BKQ A:1-212

Details for d2bkra1

PDB Entry: 2bkr, 1.9 Å

PDB Description: nedd8 nedp1 complex

PDB Compounds: (A:) Sentrin-specific protease 8

SCOP Domain Sequences for d2bkra1:

Sequence; same for both SEQRES and ATOM records:

>d2bkra1 d.3.1.7 (A:1-212) Sentrin-specific protease 8, SENP8 {Human (Homo sapiens) [TaxId: 9606]}
mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds
hsrsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffr
qqtesllqlltpayitkkrgewkdliatlakk

Timeline for d2bkra1:

• d2bkra1 is new in SCOP 1.73
  
• d2bkra1 appears in SCOP 1.75
  
• d2bkra1 appears in the current release, SCOPe 2.08, called d2bkra_