Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (22 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.7: Adenain-like [54054] (5 proteins) Pfam PF02902; Ulp1 protease family |
Protein Sentrin-specific protease 8, SENP8 [117760] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117761] (3 PDB entries) Uniprot Q96LD8 |
Domain d2bkqd1: 2bkq D:2-212 [128709] automatically matched to 2BKQ A:1-212 |
PDB Entry: 2bkq (more details), 2 Å
SCOP Domain Sequences for d2bkqd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkqd1 d.3.1.7 (D:2-212) Sentrin-specific protease 8, SENP8 {Human (Homo sapiens) [TaxId: 9606]} dpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtqf ikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhydsh srsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffrq qtesllqlltpayitkkrgewkdliatlakk
Timeline for d2bkqd1: