SCOPe 2.01: Domain d2bkqc_: 2bkq C:

Lineage for d2bkqc_ (2bkq C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (6 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein automated matches [190219] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186979] (4 PDB entries)

8. Domain d2bkqc_: 2bkq C: [128708]
   Other proteins in same PDB: d2bkqa1
   automated match to d1xt9a_

Details for d2bkqc_

PDB Entry: 2bkq, 2 Å

PDB Description: nedd8 protease

PDB Compounds: (C:) Sentrin-specific protease 8

SCOPe Domain Sequences for d2bkqc_:

Sequence, based on SEQRES records:

>d2bkqc_ d.3.1.7 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds
hsrsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffr
qqtesllqlltpayitkkrgewkdliatlakk

Sequence, based on observed residues (ATOM records):

>d2bkqc_ d.3.1.7 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds
hsrsnsvhakqvaekleaflgrlafveekapaqqnsydcgmyvicntealcqnffrqqte
sllqlltpayitkkrgewkdliatlakk

Timeline for d2bkqc_:

• d2bkqc_ first appeared in SCOP 1.73, called d2bkqc1
  
• d2bkqc_ was called d2bkqc1 in SCOP 1.75
  
• d2bkqc_ appears in SCOPe 2.02
  
• d2bkqc_ appears in the current release, SCOPe 2.08