Lineage for d2bkqc1 (2bkq C:1-212)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715176Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 715177Superfamily d.3.1: Cysteine proteinases [54001] (16 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 715568Family d.3.1.7: Adenain-like [54054] (5 proteins)
    Pfam PF02902; Ulp1 protease family
  6. 715581Protein Sentrin-specific protease 8, SENP8 [117760] (1 species)
  7. 715582Species Human (Homo sapiens) [TaxId:9606] [117761] (3 PDB entries)
  8. 715586Domain d2bkqc1: 2bkq C:1-212 [128708]
    automatically matched to 2BKQ A:1-212

Details for d2bkqc1

PDB Entry: 2bkq (more details), 2 Å

PDB Description: nedd8 protease
PDB Compounds: (C:) Sentrin-specific protease 8

SCOP Domain Sequences for d2bkqc1:

Sequence, based on SEQRES records: (download)

>d2bkqc1 d.3.1.7 (C:1-212) Sentrin-specific protease 8, SENP8 {Human (Homo sapiens) [TaxId: 9606]}
mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds
hsrsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffr
qqtesllqlltpayitkkrgewkdliatlakk

Sequence, based on observed residues (ATOM records): (download)

>d2bkqc1 d.3.1.7 (C:1-212) Sentrin-specific protease 8, SENP8 {Human (Homo sapiens) [TaxId: 9606]}
mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds
hsrsnsvhakqvaekleaflgrlafveekapaqqnsydcgmyvicntealcqnffrqqte
sllqlltpayitkkrgewkdliatlakk

SCOP Domain Coordinates for d2bkqc1:

Click to download the PDB-style file with coordinates for d2bkqc1.
(The format of our PDB-style files is described here.)

Timeline for d2bkqc1: