Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.7: Adenain-like [54054] (6 proteins) Pfam PF02902; Ulp1 protease family |
Protein automated matches [190219] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186979] (5 PDB entries) |
Domain d2bkqb_: 2bkq B: [128707] Other proteins in same PDB: d2bkqa1 automated match to d1xt9a_ |
PDB Entry: 2bkq (more details), 2 Å
SCOPe Domain Sequences for d2bkqb_:
Sequence, based on SEQRES records: (download)
>d2bkqb_ d.3.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds hsrsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffr qqtesllqlltpayitkkrgewkdliatlakk
>d2bkqb_ d.3.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds hsrsnsvhakqvaekleaflgrklafveekapaqqnsydcgmyvicntealcqnffrqqt esllqlltpayitkkrgewkdliatlakk
Timeline for d2bkqb_: