SCOPe 2.06: Domain d2bkqa1: 2bkq A:1-212

Lineage for d2bkqa1 (2bkq A:1-212)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (6 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Sentrin-specific protease 8, SENP8 [117760] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117761] (2 PDB entries)
   Uniprot Q96LD8

8. Domain d2bkqa1: 2bkq A:1-212 [128706]
   Other proteins in same PDB: d2bkqb_, d2bkqc_, d2bkqd_

Details for d2bkqa1

PDB Entry: 2bkq, 2 Å

PDB Description: nedd8 protease

PDB Compounds: (A:) Sentrin-specific protease 8

SCOPe Domain Sequences for d2bkqa1:

Sequence, based on SEQRES records:

>d2bkqa1 d.3.1.7 (A:1-212) Sentrin-specific protease 8, SENP8 {Human (Homo sapiens) [TaxId: 9606]}
mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds
hsrsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffr
qqtesllqlltpayitkkrgewkdliatlakk

Sequence, based on observed residues (ATOM records):

>d2bkqa1 d.3.1.7 (A:1-212) Sentrin-specific protease 8, SENP8 {Human (Homo sapiens) [TaxId: 9606]}
mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
fikctsnpaeiamflepldlpnkrvvflaindnsnqaagshwsllvylqdknsffhydsh
srsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffrq
qtesllqlltpayitkkrgewkdliatlakk

Timeline for d2bkqa1:

• d2bkqa1 first appeared in SCOP 1.73
  
• d2bkqa1 appears in SCOPe 2.05
  
• d2bkqa1 appears in SCOPe 2.07
  
• d2bkqa1 appears in the current release, SCOPe 2.08