Lineage for d2bkqa1 (2bkq A:1-212)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155200Family d.3.1.7: Adenain-like [54054] (6 protein domains)
    Pfam PF02902; Ulp1 protease family
  6. 2155231Protein Sentrin-specific protease 8, SENP8 [117760] (1 species)
  7. 2155232Species Human (Homo sapiens) [TaxId:9606] [117761] (2 PDB entries)
    Uniprot Q96LD8
  8. 2155233Domain d2bkqa1: 2bkq A:1-212 [128706]
    Other proteins in same PDB: d2bkqb_, d2bkqc_, d2bkqd_

Details for d2bkqa1

PDB Entry: 2bkq (more details), 2 Å

PDB Description: nedd8 protease
PDB Compounds: (A:) Sentrin-specific protease 8

SCOPe Domain Sequences for d2bkqa1:

Sequence, based on SEQRES records: (download)

>d2bkqa1 d.3.1.7 (A:1-212) Sentrin-specific protease 8, SENP8 {Human (Homo sapiens) [TaxId: 9606]}
mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds
hsrsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffr
qqtesllqlltpayitkkrgewkdliatlakk

Sequence, based on observed residues (ATOM records): (download)

>d2bkqa1 d.3.1.7 (A:1-212) Sentrin-specific protease 8, SENP8 {Human (Homo sapiens) [TaxId: 9606]}
mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
fikctsnpaeiamflepldlpnkrvvflaindnsnqaagshwsllvylqdknsffhydsh
srsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffrq
qtesllqlltpayitkkrgewkdliatlakk

SCOPe Domain Coordinates for d2bkqa1:

Click to download the PDB-style file with coordinates for d2bkqa1.
(The format of our PDB-style files is described here.)

Timeline for d2bkqa1: