Lineage for d2bkpa2 (2bkp A:108-202)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2241850Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
    beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold
  4. 2241851Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) (S)
  5. 2241852Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins)
    Pfam PF02080
  6. 2241853Protein Hypothetical protein PH0236, C-terminal domain [143625] (1 species)
  7. 2241854Species Pyrococcus horikoshii [TaxId:53953] [143626] (4 PDB entries)
    Uniprot O57975 108-201
  8. 2241857Domain d2bkpa2: 2bkp A:108-202 [128705]
    Other proteins in same PDB: d2bkpa1
    automated match to d1vcta2
    complexed with k

Details for d2bkpa2

PDB Entry: 2bkp (more details), 2.2 Å

PDB Description: structure analysis of unknown function protein
PDB Compounds: (A:) hypothetical protein ph0236

SCOPe Domain Sequences for d2bkpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkpa2 d.286.1.1 (A:108-202) Hypothetical protein PH0236, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
lhpviketilegeeiigkiqvypesvivgktlgeldlatntgvwiiavrrgkrwifgpne
nfkiragdvligrgtrtsidhlkeiargairvign

SCOPe Domain Coordinates for d2bkpa2:

Click to download the PDB-style file with coordinates for d2bkpa2.
(The format of our PDB-style files is described here.)

Timeline for d2bkpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bkpa1