Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily) beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold |
Superfamily d.286.1: TrkA C-terminal domain-like [116726] (1 family) |
Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins) Pfam PF02080 |
Protein Hypothetical protein PH0236, C-terminal domain [143625] (1 species) |
Species Pyrococcus horikoshii [TaxId:53953] [143626] (4 PDB entries) |
Domain d2bkpa2: 2bkp A:108-201 [128705] Other proteins in same PDB: d2bkpa1 automatically matched to 1VCT A:108-201 complexed with k |
PDB Entry: 2bkp (more details), 2.2 Å
SCOP Domain Sequences for d2bkpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkpa2 d.286.1.1 (A:108-201) Hypothetical protein PH0236, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} lhpviketilegeeiigkiqvypesvivgktlgeldlatntgvwiiavrrgkrwifgpne nfkiragdvligrgtrtsidhlkeiargairvig
Timeline for d2bkpa2: