![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.12: PhoU-like [109755] (2 families) ![]() duplication: consists of two sequence each repeats adopting this fold |
![]() | Family a.7.12.1: PhoU-like [109756] (3 proteins) Pfam PF01895 this is a repeat family; one repeat unit is 1vct A:9-107 found in domain |
![]() | Protein Hypothetical protein PH0236, N-terminal domain [140350] (1 species) form dimers of dimers, similar to PhoU subunits and dimers, respectively |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [140351] (4 PDB entries) Uniprot O57975 9-107 |
![]() | Domain d2bkpa1: 2bkp A:9-107 [128704] Other proteins in same PDB: d2bkpa2 automated match to d1vcta1 complexed with k |
PDB Entry: 2bkp (more details), 2.2 Å
SCOPe Domain Sequences for d2bkpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkpa1 a.7.12.1 (A:9-107) Hypothetical protein PH0236, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} yepksvkeifiemkdtvelmvdlayasllfgdkeiaeevleleeridllnyqlmmhsvla arnvkeaeqvitilqianaiedisnaagdlakmvlegve
Timeline for d2bkpa1: