SCOPe 2.08: Domain d2bkpa1: 2bkp A:9-107

Lineage for d2bkpa1 (2bkp A:9-107)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.12: PhoU-like [109755] (2 families)
   duplication: consists of two sequence each repeats adopting this fold

5. Family a.7.12.1: PhoU-like [109756] (3 proteins)
   Pfam PF01895
   this is a repeat family; one repeat unit is 1vct A:9-107 found in domain

6. Protein Hypothetical protein PH0236, N-terminal domain [140350] (1 species)
   form dimers of dimers, similar to PhoU subunits and dimers, respectively

7. Species Pyrococcus horikoshii [TaxId:53953] [140351] (4 PDB entries)
   Uniprot O57975 9-107

8. Domain d2bkpa1: 2bkp A:9-107 [128704]
   Other proteins in same PDB: d2bkpa2
   automated match to d1vcta1
   complexed with k
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d2bkpa1

PDB Entry: 2bkp, 2.2 Å

PDB Description: structure analysis of unknown function protein

PDB Compounds: (A:) hypothetical protein ph0236

SCOPe Domain Sequences for d2bkpa1:

Sequence; same for both SEQRES and ATOM records:

>d2bkpa1 a.7.12.1 (A:9-107) Hypothetical protein PH0236, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
yepksvkeifiemkdtvelmvdlayasllfgdkeiaeevleleeridllnyqlmmhsvla
arnvkeaeqvitilqianaiedisnaagdlakmvlegve

Timeline for d2bkpa1:

• d2bkpa1 first appeared in SCOP 1.73
  
• d2bkpa1 appears in SCOPe 2.07