SCOP 1.73: Domain d2bkoa2: 2bko A:108-199

Lineage for d2bkoa2 (2bko A:108-199)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
   beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold

4. Superfamily d.286.1: TrkA C-terminal domain-like [116726] (1 family)

5. Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins)
   Pfam PF02080

6. Protein Hypothetical protein PH0236, C-terminal domain [143625] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143626] (4 PDB entries)

8. Domain d2bkoa2: 2bko A:108-199 [128703]
   Other proteins in same PDB: d2bkoa1
   automatically matched to 1VCT A:108-201
   complexed with ca, cl

Details for d2bkoa2

PDB Entry: 2bko, 1.9 Å

PDB Description: structure analysis of unknown function protein

PDB Compounds: (A:) hypothetical protein ph0236

SCOP Domain Sequences for d2bkoa2:

Sequence; same for both SEQRES and ATOM records:

>d2bkoa2 d.286.1.1 (A:108-199) Hypothetical protein PH0236, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
lhpviketilegeeiigkiqvypesvivgktlgeldlatntgvwiiavrrgkrwifgpne
nfkiragdvligrgtrtsidhlkeiargairv

Timeline for d2bkoa2:

• d2bkoa2 is new in SCOP 1.73
  
• d2bkoa2 appears in SCOP 1.75
  
• d2bkoa2 appears in the current release, SCOPe 2.08