Lineage for d2bkoa2 (2bko A:108-199)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2566148Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
    beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold
  4. 2566149Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) (S)
  5. 2566150Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins)
    Pfam PF02080
  6. 2566151Protein Hypothetical protein PH0236, C-terminal domain [143625] (1 species)
  7. 2566152Species Pyrococcus horikoshii [TaxId:53953] [143626] (4 PDB entries)
    Uniprot O57975 108-201
  8. 2566154Domain d2bkoa2: 2bko A:108-199 [128703]
    Other proteins in same PDB: d2bkoa1
    automated match to d1vcta2
    complexed with ca, cl

Details for d2bkoa2

PDB Entry: 2bko (more details), 1.9 Å

PDB Description: structure analysis of unknown function protein
PDB Compounds: (A:) hypothetical protein ph0236

SCOPe Domain Sequences for d2bkoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkoa2 d.286.1.1 (A:108-199) Hypothetical protein PH0236, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
lhpviketilegeeiigkiqvypesvivgktlgeldlatntgvwiiavrrgkrwifgpne
nfkiragdvligrgtrtsidhlkeiargairv

SCOPe Domain Coordinates for d2bkoa2:

Click to download the PDB-style file with coordinates for d2bkoa2.
(The format of our PDB-style files is described here.)

Timeline for d2bkoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bkoa1