SCOP 1.73: Domain d2bkoa1: 2bko A:9-107

Lineage for d2bkoa1 (2bko A:9-107)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.7: Spectrin repeat-like [46965] (15 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.12: PhoU-like [109755] (1 family)
   duplication: consists of two sequence each repeats adopting this fold

5. Family a.7.12.1: PhoU-like [109756] (3 proteins)
   Pfam PF01895
   this is a repeat family; one repeat unit is 1vct A:9-107 found in domain

6. Protein Hypothetical protein PH0236, N-terminal domain [140350] (1 species)
   form dimers of dimers, similar to PhoU subunits and dimers, respectively

7. Species Pyrococcus horikoshii [TaxId:53953] [140351] (4 PDB entries)

8. Domain d2bkoa1: 2bko A:9-107 [128702]
   Other proteins in same PDB: d2bkoa2
   automatically matched to 1VCT A:9-107
   complexed with ca, cl

Details for d2bkoa1

PDB Entry: 2bko, 1.9 Å

PDB Description: structure analysis of unknown function protein

PDB Compounds: (A:) hypothetical protein ph0236

SCOP Domain Sequences for d2bkoa1:

Sequence; same for both SEQRES and ATOM records:

>d2bkoa1 a.7.12.1 (A:9-107) Hypothetical protein PH0236, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
yepksvkeifiemkdtvelmvdlayasllfgdkeiaeevleleeridllnyqlmmhsvla
arnvkeaeqvitilqianaiedisnaagdlakmvlegve

Timeline for d2bkoa1:

• d2bkoa1 is new in SCOP 1.73
  
• d2bkoa1 appears in SCOP 1.75
  
• d2bkoa1 appears in the current release, SCOPe 2.08