Lineage for d2bkna2 (2bkn A:108-201)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009722Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
    beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold
  4. 3009723Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) (S)
  5. 3009724Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins)
    Pfam PF02080
  6. 3009725Protein Hypothetical protein PH0236, C-terminal domain [143625] (1 species)
  7. 3009726Species Pyrococcus horikoshii [TaxId:53953] [143626] (4 PDB entries)
    Uniprot O57975 108-201
  8. 3009730Domain d2bkna2: 2bkn A:108-201 [128701]
    Other proteins in same PDB: d2bkna1
    automated match to d1vcta2
    complexed with cs

Details for d2bkna2

PDB Entry: 2bkn (more details), 2.6 Å

PDB Description: structure analysis of unknown function protein
PDB Compounds: (A:) hypothetical protein ph0236

SCOPe Domain Sequences for d2bkna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkna2 d.286.1.1 (A:108-201) Hypothetical protein PH0236, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
lhpviketilegeeiigkiqvypesvivgktlgeldlatntgvwiiavrrgkrwifgpne
nfkiragdvligrgtrtsidhlkeiargairvig

SCOPe Domain Coordinates for d2bkna2:

Click to download the PDB-style file with coordinates for d2bkna2.
(The format of our PDB-style files is described here.)

Timeline for d2bkna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bkna1