SCOPe 2.08: Domain d2bkna2: 2bkn A:108-201

Lineage for d2bkna2 (2bkn A:108-201)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
   beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold

4. Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families)

5. Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins)
   Pfam PF02080

6. Protein Hypothetical protein PH0236, C-terminal domain [143625] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143626] (4 PDB entries)
   Uniprot O57975 108-201

8. Domain d2bkna2: 2bkn A:108-201 [128701]
   Other proteins in same PDB: d2bkna1
   automated match to d1vcta2
   complexed with cs

Details for d2bkna2

PDB Entry: 2bkn, 2.6 Å

PDB Description: structure analysis of unknown function protein

PDB Compounds: (A:) hypothetical protein ph0236

SCOPe Domain Sequences for d2bkna2:

Sequence; same for both SEQRES and ATOM records:

>d2bkna2 d.286.1.1 (A:108-201) Hypothetical protein PH0236, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
lhpviketilegeeiigkiqvypesvivgktlgeldlatntgvwiiavrrgkrwifgpne
nfkiragdvligrgtrtsidhlkeiargairvig

Timeline for d2bkna2:

• d2bkna2 first appeared in SCOP 1.73
  
• d2bkna2 appears in SCOPe 2.07