Lineage for d2bkna1 (2bkn A:11-107)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309866Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2310215Superfamily a.7.12: PhoU-like [109755] (2 families) (S)
    duplication: consists of two sequence each repeats adopting this fold
  5. 2310216Family a.7.12.1: PhoU-like [109756] (3 proteins)
    Pfam PF01895
    this is a repeat family; one repeat unit is 1vct A:9-107 found in domain
  6. 2310217Protein Hypothetical protein PH0236, N-terminal domain [140350] (1 species)
    form dimers of dimers, similar to PhoU subunits and dimers, respectively
  7. 2310218Species Pyrococcus horikoshii [TaxId:53953] [140351] (4 PDB entries)
    Uniprot O57975 9-107
  8. 2310222Domain d2bkna1: 2bkn A:11-107 [128700]
    Other proteins in same PDB: d2bkna2
    automated match to d1vcta1
    complexed with cs

Details for d2bkna1

PDB Entry: 2bkn (more details), 2.6 Å

PDB Description: structure analysis of unknown function protein
PDB Compounds: (A:) hypothetical protein ph0236

SCOPe Domain Sequences for d2bkna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkna1 a.7.12.1 (A:11-107) Hypothetical protein PH0236, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
pksvkeifiemkdtvelmvdlayasllfgdkeiaeevleleeridllnyqlmmhsvlaar
nvkeaeqvitilqianaiedisnaagdlakmvlegve

SCOPe Domain Coordinates for d2bkna1:

Click to download the PDB-style file with coordinates for d2bkna1.
(The format of our PDB-style files is described here.)

Timeline for d2bkna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bkna2