![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (34 species) not a true protein |
![]() | Species Listeria innocua [TaxId:1642] [186977] (4 PDB entries) |
![]() | Domain d2bkcx_: 2bkc X: [128697] Other proteins in same PDB: d2bkca1 automated match to d1qgha_ mutant |
PDB Entry: 2bkc (more details), 2.3 Å
SCOPe Domain Sequences for d2bkcx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkcx_ a.25.1.1 (X:) automated matches {Listeria innocua [TaxId: 1642]} vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd vtndmliafkasidkhiwmfkaflgkaple
Timeline for d2bkcx_: