![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.25: Ferritin-like [47239] (4 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (5 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (9 proteins) |
![]() | Protein Dodecameric ferritin homolog [47250] (13 species) |
![]() | Species Listeria innocua [TaxId:1642] [47252] (4 PDB entries) |
![]() | Domain d2bkcr1: 2bkc R:8-156 [128692] automatically matched to 2BKC A:7-156 mutant |
PDB Entry: 2bkc (more details), 2.3 Å
SCOP Domain Sequences for d2bkcr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkcr1 a.25.1.1 (R:8-156) Dodecameric ferritin homolog {Listeria innocua [TaxId: 1642]} dtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerllai ggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegddv tndmliafkasidkhiwmfkaflgkaple
Timeline for d2bkcr1: