Lineage for d2bkcp_ (2bkc P:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702568Species Listeria innocua [TaxId:1642] [186977] (3 PDB entries)
  8. 2702599Domain d2bkcp_: 2bkc P: [128690]
    Other proteins in same PDB: d2bkca1
    automated match to d1qgha_
    mutant

Details for d2bkcp_

PDB Entry: 2bkc (more details), 2.3 Å

PDB Description: the x-ray structure of the h43g listeria innocua dps mutant
PDB Compounds: (P:) non-heme iron-containing ferritin

SCOPe Domain Sequences for d2bkcp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkcp_ a.25.1.1 (P:) automated matches {Listeria innocua [TaxId: 1642]}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOPe Domain Coordinates for d2bkcp_:

Click to download the PDB-style file with coordinates for d2bkcp_.
(The format of our PDB-style files is described here.)

Timeline for d2bkcp_: