Lineage for d2bkcn1 (2bkc N:7-156)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 638520Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 638728Protein Dodecameric ferritin homolog [47250] (13 species)
  7. 638900Species Listeria innocua [TaxId:1642] [47252] (4 PDB entries)
  8. 638920Domain d2bkcn1: 2bkc N:7-156 [128688]
    automatically matched to 2BKC A:7-156
    mutant

Details for d2bkcn1

PDB Entry: 2bkc (more details), 2.3 Å

PDB Description: the x-ray structure of the h43g listeria innocua dps mutant
PDB Compounds: (N:) non-heme iron-containing ferritin

SCOP Domain Sequences for d2bkcn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkcn1 a.25.1.1 (N:7-156) Dodecameric ferritin homolog {Listeria innocua [TaxId: 1642]}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOP Domain Coordinates for d2bkcn1:

Click to download the PDB-style file with coordinates for d2bkcn1.
(The format of our PDB-style files is described here.)

Timeline for d2bkcn1: