Lineage for d2bkce_ (2bkc E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315402Protein automated matches [190041] (34 species)
    not a true protein
  7. 2315875Species Listeria innocua [TaxId:1642] [186977] (4 PDB entries)
  8. 2315884Domain d2bkce_: 2bkc E: [128679]
    Other proteins in same PDB: d2bkca1
    automated match to d1qgha_
    mutant

Details for d2bkce_

PDB Entry: 2bkc (more details), 2.3 Å

PDB Description: the x-ray structure of the h43g listeria innocua dps mutant
PDB Compounds: (E:) non-heme iron-containing ferritin

SCOPe Domain Sequences for d2bkce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkce_ a.25.1.1 (E:) automated matches {Listeria innocua [TaxId: 1642]}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOPe Domain Coordinates for d2bkce_:

Click to download the PDB-style file with coordinates for d2bkce_.
(The format of our PDB-style files is described here.)

Timeline for d2bkce_: