Lineage for d2bkba2 (2bkb A:83-192)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552893Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2552894Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2552895Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2553167Protein automated matches [226880] (4 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [255057] (1 PDB entry)
  8. 2553179Domain d2bkba2: 2bkb A:83-192 [128668]
    Other proteins in same PDB: d2bkba1, d2bkbb1, d2bkbc1, d2bkbd1
    automated match to d2nyba2
    complexed with fe2

Details for d2bkba2

PDB Entry: 2bkb (more details), 1.7 Å

PDB Description: q69e-fesod
PDB Compounds: (A:) superoxide dismutase [fe]

SCOPe Domain Sequences for d2bkba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkba2 d.44.1.1 (A:83-192) automated matches {Escherichia coli [TaxId: 562]}
naggeptgkvaeaiaasfgsfadfkaqftdaaiknfgsgwtwlvknsdgklaivstsnag
tplttdatplltvdvwehayyidyrnarpgylehfwalvnwefvaknlaa

SCOPe Domain Coordinates for d2bkba2:

Click to download the PDB-style file with coordinates for d2bkba2.
(The format of our PDB-style files is described here.)

Timeline for d2bkba2: