SCOP 1.75: Domain d2bkba2: 2bkb A:83-192

Lineage for d2bkba2 (2bkb A:83-192)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)

7. Species Escherichia coli [TaxId:562] [54727] (6 PDB entries)

8. Domain d2bkba2: 2bkb A:83-192 [128668]
   Other proteins in same PDB: d2bkba1, d2bkbb1, d2bkbc1, d2bkbd1
   automatically matched to d1isaa2
   complexed with fe2; mutant

Details for d2bkba2

PDB Entry: 2bkb, 1.7 Å

PDB Description: q69e-fesod

PDB Compounds: (A:) superoxide dismutase [fe]

SCOP Domain Sequences for d2bkba2:

Sequence; same for both SEQRES and ATOM records:

>d2bkba2 d.44.1.1 (A:83-192) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]}
naggeptgkvaeaiaasfgsfadfkaqftdaaiknfgsgwtwlvknsdgklaivstsnag
tplttdatplltvdvwehayyidyrnarpgylehfwalvnwefvaknlaa

Timeline for d2bkba2:

• d2bkba2 first appeared in SCOP 1.73
  
• d2bkba2 appears in SCOPe 2.01
  
• d2bkba2 appears in the current release, SCOPe 2.08