Lineage for d2bkba1 (2bkb A:1-82)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760084Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 760309Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 760310Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 760338Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)
  7. 760387Species Escherichia coli [TaxId:562] [46614] (6 PDB entries)
  8. 760394Domain d2bkba1: 2bkb A:1-82 [128667]
    Other proteins in same PDB: d2bkba2, d2bkbb2, d2bkbc2, d2bkbd2
    automatically matched to d1isaa1
    complexed with fe2; mutant

Details for d2bkba1

PDB Entry: 2bkb (more details), 1.7 Å

PDB Description: q69e-fesod
PDB Compounds: (A:) superoxide dismutase [fe]

SCOP Domain Sequences for d2bkba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkba1 a.2.11.1 (A:1-82) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]}
sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
ggvfnnaaevwnhtfywnclap

SCOP Domain Coordinates for d2bkba1:

Click to download the PDB-style file with coordinates for d2bkba1.
(The format of our PDB-style files is described here.)

Timeline for d2bkba1: