Lineage for d2bkaa1 (2bka A:5-236)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842820Protein TAT-interacting protein TIP30 [141904] (2 species)
  7. 2842821Species Human (Homo sapiens) [TaxId:9606] [141905] (1 PDB entry)
    Uniprot Q9BUP3 5-236
  8. 2842822Domain d2bkaa1: 2bka A:5-236 [128666]
    complexed with gol, ndp, pe8, so4

Details for d2bkaa1

PDB Entry: 2bka (more details), 1.7 Å

PDB Description: cc3(tip30)crystal strutcure
PDB Compounds: (A:) tat-interacting protein tip30

SCOPe Domain Sequences for d2bkaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]}
ealsklredfrmqnksvfilgasgetgrvllkeileqglfskvtligrrkltfdeeaykn
vnqevvdfeklddyasafqghdvgfcclgttrgkagaegfvrvdrdyvlksaelakaggc
khfnllsskgadkssnflylqvkgeveakveelkfdrysvfrpgvllcdrqesrpgewlv
rkffgslpdswasghsvpvvtvvramlnnvvrprdkqmellenkaihdlgka

SCOPe Domain Coordinates for d2bkaa1:

Click to download the PDB-style file with coordinates for d2bkaa1.
(The format of our PDB-style files is described here.)

Timeline for d2bkaa1: