Lineage for d2bk6e_ (2bk6 E:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. Protein automated matches [190041] (33 species)
    not a true protein
  7. Species Listeria innocua [TaxId:1642] [186977] (3 PDB entries)
  8. Domain d2bk6e_: 2bk6 E: [128664]
    Other proteins in same PDB: d2bk6a1
    automated match to d1qgha_
    mutant

Details for d2bk6e_

PDB Entry: 2bk6 (more details), 2.19 Å

PDB Description: the x-ray crystal structure of the listeria innocua h31g dps mutant.
PDB Compounds: (E:) non-heme iron-containing ferritin

SCOPe Domain Sequences for d2bk6e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bk6e_ a.25.1.1 (E:) automated matches {Listeria innocua [TaxId: 1642]}
vdtkeflnhqvanlnvftvkihqigwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOPe Domain Coordinates for d2bk6e_ are not available.

Timeline for d2bk6e_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bk6a1, d2bk6b_, d2bk6c_, d2bk6d_, d2bk6f_