| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein automated matches [190041] (34 species) not a true protein |
| Species Listeria innocua [TaxId:1642] [186977] (3 PDB entries) |
| Domain d2bk6d_: 2bk6 D: [128663] Other proteins in same PDB: d2bk6a1 automated match to d1qgha_ mutant |
PDB Entry: 2bk6 (more details), 2.19 Å
SCOPe Domain Sequences for d2bk6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bk6d_ a.25.1.1 (D:) automated matches {Listeria innocua [TaxId: 1642]}
vdtkeflnhqvanlnvftvkihqigwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple
Timeline for d2bk6d_: