SCOPe 2.01: Domain d2bk6a1: 2bk6 A:7-156

Lineage for d2bk6a1 (2bk6 A:7-156)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Dodecameric ferritin homolog [47250] (14 species)

7. Species Listeria innocua [TaxId:1642] [47252] (4 PDB entries)

8. Domain d2bk6a1: 2bk6 A:7-156 [128660]
   Other proteins in same PDB: d2bk6b_, d2bk6c_, d2bk6d_, d2bk6e_, d2bk6f_
   mutant

Details for d2bk6a1

PDB Entry: 2bk6, 2.19 Å

PDB Description: the x-ray crystal structure of the listeria innocua h31g dps mutant.

PDB Compounds: (A:) non-heme iron-containing ferritin

SCOPe Domain Sequences for d2bk6a1:

Sequence; same for both SEQRES and ATOM records:

>d2bk6a1 a.25.1.1 (A:7-156) Dodecameric ferritin homolog {Listeria innocua [TaxId: 1642]}
vdtkeflnhqvanlnvftvkihqigwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

Timeline for d2bk6a1:

• d2bk6a1 first appeared in SCOP 1.73
  
• d2bk6a1 appears in SCOP 1.75
  
• d2bk6a1 appears in SCOPe 2.02
  
• d2bk6a1 appears in the current release, SCOPe 2.08