Lineage for d2bk5a1 (2bk5 A:6-289,A:402-500)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. Protein Monoamine oxidase B [69423] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [69424] (46 PDB entries)
  8. Domain d2bk5a1: 2bk5 A:6-289,A:402-500 [128656]
    Other proteins in same PDB: d2bk5a2, d2bk5b2
    automatically matched to d1o5wc1
    complexed with fad, isn; mutant

Details for d2bk5a1

PDB Entry: 2bk5 (more details), 1.83 Å

PDB Description: human monoamine oxidase b: i199f mutant in complex with isatin
PDB Compounds: (A:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d2bk5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bk5a1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
dvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgptq
nrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmddm
greipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsalwf
lwyvkqcggttrifsttnggqerkfvggsgqvserimdllgdrvklerpviyidqtrenv
lvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygrvlrq
pvdriyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqp
itttflerhlpsvpgllrligltt

SCOPe Domain Coordinates for d2bk5a1 are not available.

Timeline for d2bk5a1:

Domains from same chain:
(mouse over for more information)
d2bk5a2
Domains from other chains:
(mouse over for more information)
d2bk5b1, d2bk5b2