Lineage for d2bk3b2 (2bk3 B:290-401)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180483Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2180484Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2180697Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 2180750Protein Monoamine oxidase B [69673] (2 species)
  7. 2180751Species Human (Homo sapiens) [TaxId:9606] [69674] (39 PDB entries)
  8. 2180787Domain d2bk3b2: 2bk3 B:290-401 [128651]
    Other proteins in same PDB: d2bk3a1, d2bk3b1
    automated match to d1s3ea2
    complexed with fad, foh

Details for d2bk3b2

PDB Entry: 2bk3 (more details), 1.8 Å

PDB Description: human monoamine oxidase b in complex with farnesol
PDB Compounds: (B:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d2bk3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bk3b2 d.16.1.5 (B:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

SCOPe Domain Coordinates for d2bk3b2:

Click to download the PDB-style file with coordinates for d2bk3b2.
(The format of our PDB-style files is described here.)

Timeline for d2bk3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bk3b1