SCOPe 2.02: Domain d2bk3b2: 2bk3 B:290-401

Lineage for d2bk3b2 (2bk3 B:290-401)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)

6. Protein Monoamine oxidase B [69673] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69674] (28 PDB entries)

8. Domain d2bk3b2: 2bk3 B:290-401 [128651]
   Other proteins in same PDB: d2bk3a1, d2bk3b1
   automatically matched to d1o5wa2
   complexed with fad, foh

Details for d2bk3b2

PDB Entry: 2bk3, 1.8 Å

PDB Description: human monoamine oxidase b in complex with farnesol

PDB Compounds: (B:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d2bk3b2:

Sequence; same for both SEQRES and ATOM records:

>d2bk3b2 d.16.1.5 (B:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

Timeline for d2bk3b2:

• d2bk3b2 first appeared in SCOP 1.73
  
• d2bk3b2 appears in SCOPe 2.01
  
• d2bk3b2 appears in SCOPe 2.03
  
• d2bk3b2 appears in the current release, SCOPe 2.08