| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
| Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
| Protein automated matches [190218] (22 species) not a true protein |
| Species Celery (Apium graveolens) [TaxId:4045] [186978] (1 PDB entry) |
| Domain d2bk0b_: 2bk0 B: [128647] Other proteins in same PDB: d2bk0a1 automated match to d1qmra_ |
PDB Entry: 2bk0 (more details), 2.9 Å
SCOPe Domain Sequences for d2bk0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bk0b_ d.129.3.0 (B:) automated matches {Celery (Apium graveolens) [TaxId: 4045]}
gvqthvleltssvsaekifqgfvidvdtvlpkaapgayksveikgdggpgtlkiitlpdg
gpittmtlridgvnkealtfdysvidgdillgfiesienhvvlvptadggsickttaifh
tkgdavvpeenikyaneqntalfkaleaylian
Timeline for d2bk0b_: