Lineage for d2bk0b_ (2bk0 B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1218105Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1218323Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1218562Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 1218563Protein automated matches [190218] (6 species)
    not a true protein
  7. 1218564Species Celery (Apium graveolens) [TaxId:4045] [186978] (1 PDB entry)
  8. 1218565Domain d2bk0b_: 2bk0 B: [128647]
    Other proteins in same PDB: d2bk0a1
    automated match to d1qmra_

Details for d2bk0b_

PDB Entry: 2bk0 (more details), 2.9 Å

PDB Description: crystal structure of the major celery allergen api g 1
PDB Compounds: (B:) major allergen api g 1

SCOPe Domain Sequences for d2bk0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bk0b_ d.129.3.0 (B:) automated matches {Celery (Apium graveolens) [TaxId: 4045]}
gvqthvleltssvsaekifqgfvidvdtvlpkaapgayksveikgdggpgtlkiitlpdg
gpittmtlridgvnkealtfdysvidgdillgfiesienhvvlvptadggsickttaifh
tkgdavvpeenikyaneqntalfkaleaylian

SCOPe Domain Coordinates for d2bk0b_:

Click to download the PDB-style file with coordinates for d2bk0b_.
(The format of our PDB-style files is described here.)

Timeline for d2bk0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bk0a1