SCOP 1.73: Domain d2bk0b1: 2bk0 B:2-154

Lineage for d2bk0b1 (2bk0 B:2-154)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.129: TBP-like [55944] (10 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (7 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (4 proteins)

6. Protein Major allergen api g 1 [143819] (1 species)

7. Species Celery (Apium graveolens) [TaxId:4045] [143820] (1 PDB entry)

8. Domain d2bk0b1: 2bk0 B:2-154 [128647]
   automatically matched to 2BK0 A:2-154

Details for d2bk0b1

PDB Entry: 2bk0, 2.9 Å

PDB Description: crystal structure of the major celery allergen api g 1

PDB Compounds: (B:) major allergen api g 1

SCOP Domain Sequences for d2bk0b1:

Sequence; same for both SEQRES and ATOM records:

>d2bk0b1 d.129.3.1 (B:2-154) Major allergen api g 1 {Celery (Apium graveolens) [TaxId: 4045]}
gvqthvleltssvsaekifqgfvidvdtvlpkaapgayksveikgdggpgtlkiitlpdg
gpittmtlridgvnkealtfdysvidgdillgfiesienhvvlvptadggsickttaifh
tkgdavvpeenikyaneqntalfkaleaylian

Timeline for d2bk0b1:

• d2bk0b1 is new in SCOP 1.73
  
• d2bk0b1 appears in SCOP 1.75
  
• d2bk0b1 appears in the current release, SCOPe 2.08, called d2bk0b_