SCOPe 2.08: Domain d2bk0b_: 2bk0 B:

Lineage for d2bk0b_ (2bk0 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (21 species)
   not a true protein

7. Species Celery (Apium graveolens) [TaxId:4045] [186978] (1 PDB entry)

8. Domain d2bk0b_: 2bk0 B: [128647]
   Other proteins in same PDB: d2bk0a1
   automated match to d1qmra_

Details for d2bk0b_

PDB Entry: 2bk0, 2.9 Å

PDB Description: crystal structure of the major celery allergen api g 1

PDB Compounds: (B:) major allergen api g 1

SCOPe Domain Sequences for d2bk0b_:

Sequence; same for both SEQRES and ATOM records:

>d2bk0b_ d.129.3.0 (B:) automated matches {Celery (Apium graveolens) [TaxId: 4045]}
gvqthvleltssvsaekifqgfvidvdtvlpkaapgayksveikgdggpgtlkiitlpdg
gpittmtlridgvnkealtfdysvidgdillgfiesienhvvlvptadggsickttaifh
tkgdavvpeenikyaneqntalfkaleaylian

Timeline for d2bk0b_:

• d2bk0b_ first appeared in SCOP 1.73, called d2bk0b1
  
• d2bk0b_ appears in SCOPe 2.07