SCOPe 2.03: Domain d2bk0a1: 2bk0 A:2-154

Lineage for d2bk0a1 (2bk0 A:2-154)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)

6. Protein Major allergen api g 1 [143819] (1 species)

7. Species Celery (Apium graveolens) [TaxId:4045] [143820] (1 PDB entry)
   Uniprot P49372 2-154

8. Domain d2bk0a1: 2bk0 A:2-154 [128646]
   Other proteins in same PDB: d2bk0b_

Details for d2bk0a1

PDB Entry: 2bk0, 2.9 Å

PDB Description: crystal structure of the major celery allergen api g 1

PDB Compounds: (A:) major allergen api g 1

SCOPe Domain Sequences for d2bk0a1:

Sequence; same for both SEQRES and ATOM records:

>d2bk0a1 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery (Apium graveolens) [TaxId: 4045]}
gvqthvleltssvsaekifqgfvidvdtvlpkaapgayksveikgdggpgtlkiitlpdg
gpittmtlridgvnkealtfdysvidgdillgfiesienhvvlvptadggsickttaifh
tkgdavvpeenikyaneqntalfkaleaylian

Timeline for d2bk0a1:

• d2bk0a1 first appeared in SCOP 1.73
  
• d2bk0a1 appears in SCOPe 2.02
  
• d2bk0a1 appears in SCOPe 2.04
  
• d2bk0a1 appears in the current release, SCOPe 2.08