Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Listeria innocua [TaxId:1642] [186977] (4 PDB entries) |
Domain d2bjyg_: 2bjy G: [128640] Other proteins in same PDB: d2bjya1 automated match to d1qgha_ mutant |
PDB Entry: 2bjy (more details), 2.6 Å
SCOPe Domain Sequences for d2bjyg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bjyg_ a.25.1.1 (G:) automated matches {Listeria innocua [TaxId: 1642]} vdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdevaerlla iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd vtndmliafkasidkhiwmfkaflgkaple
Timeline for d2bjyg_: