SCOPe 2.08: Domain d2bjsa_: 2bjs A:

Lineage for d2bjsa_ (2bjs A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins)
   common fold is rather distorted

6. Protein automated matches [190217] (4 species)
   not a true protein

7. Species Emericella nidulans [TaxId:162425] [186976] (12 PDB entries)

8. Domain d2bjsa_: 2bjs A: [128632]
   automated match to d1bk0__
   complexed with acv, fe, mee, so4; mutant

Details for d2bjsa_

PDB Entry: 2bjs, 1.3 Å

PDB Description: isopenicillin n synthase c-terminal truncation mutant

PDB Compounds: (A:) isopenicillin n synthetase

SCOPe Domain Sequences for d2bjsa_:

Sequence; same for both SEQRES and ATOM records:

>d2bjsa_ b.82.2.1 (A:) automated matches {Emericella nidulans [TaxId: 162425]}
svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
ngksdreplsygdylqnglv

Timeline for d2bjsa_:

• d2bjsa_ first appeared in SCOP 1.73, called d2bjsa1
  
• d2bjsa_ appears in SCOPe 2.07